{
  "id": 612553,
  "title": "Same UniProt IDs but different protein sequences in cafa5 and cafa6",
  "url": "/competitions/cafa-6-protein-function-prediction/discussion/612553",
  "author_name": "",
  "post_date": "2025-10-20T14:21:44.659184800Z",
  "votes": 2,
  "comment_count": 2,
  "views": 0,
  "content": "<p>I'm looking into the relationship between the cafa5 and cafa6 data.</p>\n<p>I expect the successor to the cafa5 data to be the cafa6 data, but there are UniProt IDs with the same UniProt ID but different protein sequences.<br>\n(Google Translate.)</p>\n<p>example:<br>\nP0DJI8<br>\ncafa6:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG<strong><em>A</em></strong>WAAE<strong><em>V</em></strong>I<strong><em>T</em></strong>DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY<br>\ncafa5:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG<strong><em>V</em></strong>WAAE<strong><em>A</em></strong>I<strong><em>S</em></strong>DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY</p>",
  "messages": [
    {
      "id": "3304432",
      "postDate": "10/20/2025 14:21:44",
      "content": "<p>I'm looking into the relationship between the cafa5 and cafa6 data.</p>\n<p>I expect the successor to the cafa5 data to be the cafa6 data, but there are UniProt IDs with the same UniProt ID but different protein sequences.<br>\n(Google Translate.)</p>\n<p>example:<br>\nP0DJI8<br>\ncafa6:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG<strong><em>A</em></strong>WAAE<strong><em>V</em></strong>I<strong><em>T</em></strong>DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY<br>\ncafa5:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG<strong><em>V</em></strong>WAAE<strong><em>A</em></strong>I<strong><em>S</em></strong>DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY</p>",
      "rawMarkdown": "I'm looking into the relationship between the cafa5 and cafa6 data.\n\nI expect the successor to the cafa5 data to be the cafa6 data, but there are UniProt IDs with the same UniProt ID but different protein sequences.\n(Google Translate.)\n\nexample:\nP0DJI8\ncafa6:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG***A***WAAE***V***I***T***DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY\ncafa5:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG***V***WAAE***A***I***S***DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY",
      "votes": null
    },
    {
      "id": "3304444",
      "postDate": "10/20/2025 15:01:59",
      "content": "<p>Yes, UniProt sometimes updates the sequences of the proteins, which can be tracked <a href=\"https://www.uniprot.org/uniprotkb/P0DJI8/history\" target=\"_blank\">here for P0DJI8</a>. The protein \"P0DJI8\" has its sequence changed from release 2024_01 (entry version 86, and remained the same until now). CAFA5 happened before this sequence change, therefore it has an older version of the sequence. The same might apply to all the proteins in your Excel file.</p>",
      "rawMarkdown": "Yes, UniProt sometimes updates the sequences of the proteins, which can be tracked [here for P0DJI8](https://www.uniprot.org/uniprotkb/P0DJI8/history). The protein \"P0DJI8\" has its sequence changed from release 2024_01 (entry version 86, and remained the same until now). CAFA5 happened before this sequence change, therefore it has an older version of the sequence. The same might apply to all the proteins in your Excel file.",
      "votes": null
    },
    {
      "id": "3304484",
      "postDate": "10/20/2025 16:04:07",
      "content": "<p>Thank you for your reply. </p>",
      "rawMarkdown": "Thank you for your reply.",
      "votes": null
    }
  ],
  "comments": [
    {
      "id": 3304444,
      "author_name": "ahphan",
      "author_url": "",
      "post_date": "10/20/2025 15:01:59",
      "content": "<p>Yes, UniProt sometimes updates the sequences of the proteins, which can be tracked <a href=\"https://www.uniprot.org/uniprotkb/P0DJI8/history\" target=\"_blank\">here for P0DJI8</a>. The protein \"P0DJI8\" has its sequence changed from release 2024_01 (entry version 86, and remained the same until now). CAFA5 happened before this sequence change, therefore it has an older version of the sequence. The same might apply to all the proteins in your Excel file.</p>",
      "votes": null,
      "replies": [
        {
          "id": 3304484,
          "author_name": "kttproc",
          "author_url": "",
          "post_date": "10/20/2025 16:04:07",
          "content": "<p>Thank you for your reply. </p>",
          "votes": null,
          "replies": []
        }
      ]
    }
  ],
  "raw_markdown_by_id": {
    "3304432": "I'm looking into the relationship between the cafa5 and cafa6 data.\n\nI expect the successor to the cafa5 data to be the cafa6 data, but there are UniProt IDs with the same UniProt ID but different protein sequences.\n(Google Translate.)\n\nexample:\nP0DJI8\ncafa6:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG***A***WAAE***V***I***T***DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY\ncafa5:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGG***V***WAAE***A***I***S***DARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY",
    "3304444": "Yes, UniProt sometimes updates the sequences of the proteins, which can be tracked [here for P0DJI8](https://www.uniprot.org/uniprotkb/P0DJI8/history). The protein \"P0DJI8\" has its sequence changed from release 2024_01 (entry version 86, and remained the same until now). CAFA5 happened before this sequence change, therefore it has an older version of the sequence. The same might apply to all the proteins in your Excel file.",
    "3304484": "Thank you for your reply."
  },
  "source": "meta"
}